DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and UBA5

DIOPT Version :10

Sequence 1:NP_648435.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_079094.1 Gene:UBA5 / 79876 HGNCID:23230 Length:404 Species:Homo sapiens


Alignment Length:101 Identity:30/101 - (29%)
Similarity:43/101 - (42%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEEDLGNNFFLDSSYLGKSKALACMQLLQELN 102
            |.:|.|..||..||:.|...|||...:.|...|:..:: |..|......|.||..|....|:.:|
Human    76 VAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANM-NRLFFQPHQAGLSKVQAAEHTLRNIN 139

  Fly   103 PDVNGDYVDESADFLLANRPNFFDSFDLVIASNLNE 138
            |||    :.|..::.:....||....|.:....|.|
Human   140 PDV----LFEVHNYNITTVENFQHFMDRISNGGLEE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_648435.1 APPBP1_RUB 16..522 CDD:238770 30/101 (30%)
UBA5NP_079094.1 ThiF_MoeB_HesA_family 52..297 CDD:238386 30/101 (30%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000269|PubMed:26929408, ECO:0000269|PubMed:27653677 334..346
Linker. /evidence=ECO:0000269|PubMed:34588452 347..377
UFC1-binding sequence (UFC). /evidence=ECO:0000269|PubMed:34588452 389..404
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.