DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and Mocs3

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001153802.1 Gene:Mocs3 / 69372 MGIID:1916622 Length:460 Species:Mus musculus


Alignment Length:107 Identity:33/107 - (30%)
Similarity:49/107 - (45%) Gaps:5/107 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PAPKSPELS---DKSKKYDRQIRL--WGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFT 63
            |.|.:|..:   |:..:|.||:.|  .|..||..|.||.|.:|....:||..|:.|...|:|...
Mouse    46 PPPLAPRAALSRDEILRYSRQLLLPELGVRGQLRLAAAAVLVVGCGGLGCPLAQYLAAAGVGRLG 110

  Fly    64 VADGSTVKEEDLGNNFFLDSSYLGKSKALACMQLLQELNPDV 105
            :.|...|:..:|........:..|:|||.:....|:.||..|
Mouse   111 LVDHDVVETSNLARQVLHGEAQAGESKARSAAAALRRLNSAV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 29/92 (32%)
ThiF 17..>171 CDD:223552 29/91 (32%)
Mocs3NP_001153802.1 PRK07411 56..460 CDD:180967 30/97 (31%)
ThiF_MoeB_HesA_family 62..285 CDD:238386 29/91 (32%)
RHOD_ThiF 327..460 CDD:238784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.