powered by:
Protein Alignment APP-BP1 and mRpL36
DIOPT Version :9
Sequence 1: | NP_001261699.1 |
Gene: | APP-BP1 / 39244 |
FlyBaseID: | FBgn0261112 |
Length: | 524 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_652658.1 |
Gene: | mRpL36 / 59151 |
FlyBaseID: | FBgn0042112 |
Length: | 128 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 19/61 - (31%) |
Similarity: | 24/61 - (39%) |
Gaps: | 20/61 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 RLW-------GEHGQTLLEAATVC------LVNVTAVGCETAKGLVLPG------IGGFTV 64
||| |.|..|...|..:. ||..|...|:|: ||:.|| :.||.|
Fly 13 RLWNGLSAARGFHLLTRPAAPAIVSIQSSQLVAATTGICQTS-GLLTPGSTLVQQVAGFKV 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0476 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.