DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and uba5

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001004790.1 Gene:uba5 / 448010 XenbaseID:XB-GENE-955661 Length:399 Species:Xenopus tropicalis


Alignment Length:104 Identity:32/104 - (30%)
Similarity:44/104 - (42%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TVCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEEDLGNNFFLDSSYLGKSKALACMQLLQEL 101
            ||.:|.|..||..||:.|...|||...:.|...|:..:: |..|......|.||..|....|:.:
 Frog    71 TVAVVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVEMANM-NRLFFQPHQAGLSKVEAAEHTLRNI 134

  Fly   102 NPDVNGDYVDESADFLLANRPNFFDSFDLVIASNLNEQT 140
            ||||.    .|..::.:....||....|.:....|.|.|
 Frog   135 NPDVQ----FEVHNYNITTLDNFQHFMDRISKGGLKEGT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 32/104 (31%)
ThiF 17..>171 CDD:223552 32/104 (31%)
uba5NP_001004790.1 ThiF_MoeB_HesA_family 48..293 CDD:238386 32/104 (31%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 331..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.