DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and Atg7

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_611350.1 Gene:Atg7 / 37141 FlyBaseID:FBgn0034366 Length:684 Species:Drosophila melanogaster


Alignment Length:334 Identity:63/334 - (18%)
Similarity:102/334 - (30%) Gaps:145/334 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 EMKADEENYEEAIKAVN-----------------TAFG-AGQVPK----SLKAIFEDDACEQLNK 292
            |:|.|.:...::.:::.                 ||:. ..:.||    ::..|:..:..|:.  
  Fly    28 ELKLDHDRLSDSKRSITGHYTNRNASGCLLEVDYTAYNRMAKPPKFSHSAIGTIYNKNTIEEF-- 90

  Fly   293 KSNVFWIMAKALKHFVIHENEGHLPLP-----GVLPDMTANTDSYIALQHIYRQQALQDADQVYH 352
                     |||....:..:||...|.     |.|.|.:..|..::          |..||.   
  Fly    91 ---------KALDKLQLLADEGKELLADMCSGGALRDPSLLTRFFV----------LSFADL--- 133

  Fly   353 KCQEYLKQLALPADSIDERSVRLICKEAAGLAVIRGTRIAEEYEKSSRLLPLVEDNELQG----- 412
            ||..|....|.|.                                     ||....:|||     
  Fly   134 KCHSYYYWFAFPC-------------------------------------PLTPTLKLQGAVQKL 161

  Fly   413 ----NLTAYNFALRAY----ERFLSECGNIPGECIVEQDIGRLKSIAAKMLSDLGMHATISDDVL 469
                |.::|..||:|.    :.|.....|      ||::|     ..|:.||.|       ||..
  Fly   162 RDLPNSSSYIMALKALPTESQNFFILYAN------VEKNI-----FEARSLSSL-------DDKN 208

  Fly   470 HEICRYGGAE------------------LHAVSAFIGGCAAQEVIKII---TKQYKPIDNTFIYN 513
            .|.|.:|.|:                  |....:|:|     :.:|.:   ..|...||::.::.
  Fly   209 VEFCYFGFADPSEYEHPAWIMRNYAAFLLQQCPSFVG-----KPLKFLGLRHNQQMNIDDSLVWK 268

  Fly   514 AITTESVTL 522
            .|.||:..|
  Fly   269 VIQTEACDL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 62/332 (19%)
ThiF 17..>171 CDD:223552
Atg7NP_611350.1 ATG7_N 9..303 CDD:293029 63/334 (19%)
E1_like_apg7 11..682 CDD:273590 63/334 (19%)
Apg7 341..658 CDD:238763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446863
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.