DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and Uba5

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_572722.2 Gene:Uba5 / 32094 FlyBaseID:FBgn0030305 Length:404 Species:Drosophila melanogaster


Alignment Length:148 Identity:40/148 - (27%)
Similarity:56/148 - (37%) Gaps:35/148 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KKYDRQIRLWGEHGQTLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEEDLGNNFF 80
            |.|:|            :....|.:|.|..||..||..|...|||...:.|...|:..:: |..|
  Fly    66 KDYER------------IRYKAVAIVGVGGVGSVTADMLTRCGIGKLILFDYDKVELANM-NRLF 117

  Fly    81 LDSSYLGKSKALACMQLLQELNPDV-------NGDYVDESADFL--------LANRP-----NFF 125
            ......|.||..|....|..:||||       |...|:....||        :|.:|     :..
  Fly   118 FTPDQAGLSKVAAAAATLSFINPDVEIETHNYNITTVENFDRFLDTISQGGRIAGQPVDLVLSCV 182

  Fly   126 DSFDLVIASN--LNEQTL 141
            |:|:..:|.|  .||:.|
  Fly   183 DNFEARMAINAACNERNL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 40/148 (27%)
ThiF 17..>171 CDD:223552 39/147 (27%)
Uba5NP_572722.2 ThiF_MoeB_HesA_family 52..297 CDD:238386 40/148 (27%)
ThiF 53..310 CDD:279270 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446841
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10953
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.