DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and Uba5

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001009669.1 Gene:Uba5 / 300968 RGDID:1311702 Length:403 Species:Rattus norvegicus


Alignment Length:361 Identity:72/361 - (19%)
Similarity:116/361 - (32%) Gaps:125/361 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEEDLGNNFFLDSSYLGKSKALACMQLLQELN 102
            |.:|.|..||..||:.|...|||...:.|...|:..:: |..|......|.||..|....|:.:|
  Rat    74 VAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANM-NRLFFQPYQAGMSKVQAAEHTLRSIN 137

  Fly   103 PDV-----------------------NGDYVD-ESADFLLANRPNFFDSFD-------------- 129
            |||                       ||...: :..|.:|    :..|:|:              
  Rat   138 PDVLFEVHNYNITTVEHFEHFMNRISNGGLEEGQPVDLVL----SCVDNFEARMAINTACNELGQ 198

  Fly   130 --------------------------------LVIASNLNEQTLLLLAERLWELNVPLIYCRSLG 162
                                            ||:|||::|:|  |..|.:...::|.......|
  Rat   199 TWMESGVSENAVSGHIQLMVPGESACFACAPPLVVASNIDEKT--LKREGVCAASLPTTMGVVAG 261

  Fly   163 ML-----------GTIRLQIREHCIVEAHP-----DNRQFD---LRLEHPFDALREHLDGTEVTS 208
            :|           ||:...:..:.:.:..|     .|.|.|   .|.:......|.....|:.|:
  Rat   262 ILVQNVLKFLLKFGTVSFYLGYNAMQDFFPTMFMKPNPQCDDKNCRKQQEEYKKRAPAQPTQETA 326

  Fly   209 KVPWLLVLHKYLNVWQKQQADGTQTPRNYKEKNQLKETIREEMKADEENYEEAIKAVNTAFGAGQ 273
            ......|:|:. |.|      |.:.         :.|...||:|..........:.:..|:   .
  Rat   327 PQEEEEVVHED-NEW------GIEL---------VSEVSEEELKNSSGPVPTLPEGITVAY---T 372

  Fly   274 VPK----SLKAIFEDDACEQLNKKSNVFWIMAKALK 305
            |||    |:..:..:|:.|.|..      :||:..|
  Rat   373 VPKKREDSVSEVTVEDSGESLED------LMARMKK 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 72/361 (20%)
ThiF 17..>171 CDD:223552 44/213 (21%)
Uba5NP_001009669.1 ThiF_MoeB_HesA_family 50..293 CDD:238386 45/225 (20%)
ThiF 51..307 CDD:279270 48/239 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337 6/30 (20%)
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345 5/27 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.