DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and atg-7

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_502064.1 Gene:atg-7 / 178005 WormBaseID:WBGene00010882 Length:647 Species:Caenorhabditis elegans


Alignment Length:131 Identity:29/131 - (22%)
Similarity:49/131 - (37%) Gaps:34/131 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DKSKKYDRQIRL------------WGEHGQTLLEAAT---VCLVNVTAVGCETAKGLVLPGIGGF 62
            |.||::|.:|.:            |..|....||..:   |.::....:||..|:.|:..|:...
 Worm   287 DLSKEFDPKILMERSVDLNLSLIKWRLHPDIQLERYSQLKVLILGAGTLGCNIARCLIGWGVRHI 351

  Fly    63 TVADGSTVK-----EEDLGNNFFLDSSYLGKSKALACMQLLQELNPDVN-----------GDYVD 111
            :..|.|||.     .:.|..   .:.:.||:.||......:|.:.|.:.           |..:|
 Worm   352 SFLDNSTVSYNNPVRQSLSE---FEDARLGRGKAETAQAAIQRIFPSIQATAHRLTVPMPGHSID 413

  Fly   112 E 112
            |
 Worm   414 E 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 27/128 (21%)
ThiF 17..>171 CDD:223552 26/127 (20%)
atg-7NP_502064.1 E1_like_apg7 4..635 CDD:273590 29/131 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.