DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP-BP1 and UBA2

DIOPT Version :9

Sequence 1:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_005258461.2 Gene:UBA2 / 10054 HGNCID:30661 Length:752 Species:Homo sapiens


Alignment Length:280 Identity:67/280 - (23%)
Similarity:104/280 - (37%) Gaps:56/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TLLEAATVCLVNVTAVGCETAKGLVLPGIGGFTVADGSTVKEEDLGNNFFLDSSYLGKSKALACM 95
            |..:..|:.|..|..|..:....|..|.:.|..: |..|:...:|...|.....::|:|||....
Human   126 TCHQGLTILLRLVLKVWAQAILSLCPPKVLGLQI-DLDTIDVSNLNRQFLFQKKHVGRSKAQVAK 189

  Fly    96 QLLQELNPD----------VNGDYVDESADFLLANRPNFFDSFDLVI------ASNLNEQTLLLL 144
            :.:.:..|.          :|.||..|           ||..|.||:      |:..:...:.|.
Human   190 ESVLQFYPKANIVAYHDSIMNPDYNVE-----------FFRQFILVMNALDNRAARNHVNRMCLA 243

  Fly   145 AERLWELNVPLIYCRSLGMLG---TIRLQIREHCIVEAHPDNRQFDLRLEHPFDALREHLDGTEV 206
            |:      ||||...:.|.||   ||:..:.| | .|.||...|      ..|.........:|.
Human   244 AD------VPLIESGTAGYLGQVTTIKKGVTE-C-YECHPKPTQ------RTFPGCTIRNTPSEP 294

  Fly   207 TSKVPWLLVLHKYL--NVWQKQQADGTQTPRNYKEKNQLKETIREEMKADEENYEEAIKAVNT-- 267
            ...:.|.    |||  .::.::.||...:| :..:.....|....|.:|...|.:..||.::|  
Human   295 IHCIVWA----KYLFNQLFGEEDADQEVSP-DRADPEAAWEPTEAEARARASNEDGDIKRISTKE 354

  Fly   268 -AFGAGQVP-KSLKAIFEDD 285
             |...|..| |....:|:||
Human   355 WAKSTGYDPVKLFTKLFKDD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 67/280 (24%)
ThiF 17..>171 CDD:223552 38/158 (24%)
UBA2XP_005258461.2 Uba2_SUMO 159..556 CDD:238766 59/247 (24%)
UBA_e1_thiolCys 291..474 CDD:287545 22/89 (25%)
UAE_UbL 564..650 CDD:291402
UBA2_C 661..747 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.