DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and bZIP19

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_567974.1 Gene:bZIP19 / 829656 AraportID:AT4G35040 Length:261 Species:Arabidopsis thaliana


Alignment Length:89 Identity:30/89 - (33%)
Similarity:42/89 - (47%) Gaps:11/89 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SDSPLSPHTDDPAYK-----EKRK-KNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIE- 72
            ||..:|  |||.|..     |||. .|.|||::.|||.|..|...:..:..||..|..|..::: 
plant    75 SDEKVS--TDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLEDEVARLRAVNQQLVKRLQN 137

  Fly    73 --TSEKHISTLRDLIIQGEKTEDG 94
              |.|..:|.|:.|::......||
plant   138 QATLEAEVSRLKCLLVDLRGRIDG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 23/67 (34%)
coiled coil 25..83 CDD:269841 22/66 (33%)
bZIP19NP_567974.1 BRLZ 91..152 CDD:197664 20/60 (33%)
coiled coil 93..146 CDD:269834 18/52 (35%)

Return to query results.
Submit another query.