DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and BZIP24

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_190764.2 Gene:BZIP24 / 824359 AraportID:AT3G51960 Length:228 Species:Arabidopsis thaliana


Alignment Length:77 Identity:21/77 - (27%)
Similarity:36/77 - (46%) Gaps:4/77 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSA---EERKKRIDDLRKQNDALKVQIETSE 75
            :.|...:.|:|. :.|::...|.|||::.|||.|...   |:...|:..|.:|........|..|
plant    85 SQDQQENDHSDS-SNKKRLCGNREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQSQEMVE 148

  Fly    76 KHISTLRDLIIQ 87
            ..:..||.|:::
plant   149 TELIRLRALLVE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 17/61 (28%)
coiled coil 25..83 CDD:269841 16/60 (27%)
BZIP24NP_190764.2 bZIP_2 104..146 CDD:462244 12/41 (29%)

Return to query results.
Submit another query.