DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and HYH

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_850605.1 Gene:HYH / 821027 AraportID:AT3G17609 Length:149 Species:Arabidopsis thaliana


Alignment Length:116 Identity:30/116 - (25%)
Similarity:48/116 - (41%) Gaps:21/116 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAKKRTAASTSKNSDSPLSPHTD---------------DPAYKEKRK-----KNNEAVQRTREK 45
            |.|...|...:|...|...:|..|               :|..||.|.     :|..:.|:.||:
plant    34 MEAAGSTCVLSSSADDGVNNPELDQTQNGVSTAKRRRGRNPVDKEYRSLKRLLRNRVSAQQARER 98

  Fly    46 TKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE-KTEDGH 95
            .|....:.:.|.::|:..||.|:.:|.|.....:.||.::|... ||:|.|
plant    99 KKVYVSDLESRANELQNNNDQLEEKISTLTNENTMLRKMLINTRPKTDDNH 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 18/78 (23%)
coiled coil 25..83 CDD:269841 17/62 (27%)
HYHNP_850605.1 bZIP_HY5-like 82..131 CDD:269852 12/48 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.