DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Irbp18 and TEF

DIOPT Version :9

Sequence 1:	NP_001261698.1	Gene:	Irbp18 / 39243	FlyBaseID:	FBgn0036126	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	NP_003207.1	Gene:	TEF / 7008	HGNCID:	11722	Length:	303	Species:	Homo sapiens

Alignment Length:	65	Identity:	18/65 - (27%)
Similarity:	33/65 - (50%)	Gaps:	0/65 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 DPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE 89
            |..|..:|||||.|.:|:|:..:....:...|...|.|:|.||:.::....|.:...:.::.:.|
Human   233 DEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAELRKEVGKCKTIVSKYE 297

Fly 90 89
Human 298 297

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Irbp18	NP_001261698.1	bZIP_CEBP	24..83	CDD:269841	17/57 (30%)
Irbp18	NP_001261698.1	coiled coil	25..83	CDD:269841	17/57 (30%)
TEF	NP_003207.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..63
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	132..176
		bZIP_HLF	232..290	CDD:269843	17/56 (30%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	235..255		9/19 (47%)
		coiled coil	236..287	CDD:269843	16/50 (32%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	256..263		0/6 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3119
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810