DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and cebpb

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001030293.1 Gene:cebpb / 619595 XenbaseID:XB-GENE-479779 Length:145 Species:Xenopus tropicalis


Alignment Length:82 Identity:27/82 - (32%)
Similarity:51/82 - (62%) Gaps:5/82 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQ 70
            ::.:|..|.|   |..|:|:  ||.:|::||.||:::|:|.|....|.:.::.:|..:|:.|:.:
 Frog    57 KSGSSKGKKS---LDKHSDE--YKIRRERNNIAVRKSRDKAKIRNMETQHKVLELSAENERLQKR 116

  Fly    71 IETSEKHISTLRDLIIQ 87
            :|...:.:||||:|..|
 Frog   117 VEQLSRELSTLRNLFKQ 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 19/58 (33%)
coiled coil 25..83 CDD:269841 18/57 (32%)
cebpbNP_001030293.1 bZIP_CEBPB 67..134 CDD:269860 24/69 (35%)
coiled coil 71..132 CDD:269860 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.