DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and dbpa

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001183989.1 Gene:dbpa / 565056 ZFINID:ZDB-GENE-060503-802 Length:366 Species:Danio rerio


Alignment Length:71 Identity:20/71 - (28%)
Similarity:35/71 - (49%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE 89
            |..|..:|.||:||.:|:|:..:....:...|...|.::|.||:.::....|.:...|::|   .
Zfish   296 DDKYWCRRLKNDEAAKRSRDARRLKENQISVRAAFLERENAALRQEVADMRKELGRCRNII---N 357

  Fly    90 KTEDGH 95
            |.|..|
Zfish   358 KYESRH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 15/57 (26%)
coiled coil 25..83 CDD:269841 15/57 (26%)
dbpaNP_001183989.1 bZIP_HLF 295..354 CDD:269843 15/57 (26%)
coiled coil 296..354 CDD:269843 15/57 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.