powered by:
Protein Alignment Irbp18 and tef
DIOPT Version :9
Sequence 1: | NP_001261698.1 |
Gene: | Irbp18 / 39243 |
FlyBaseID: | FBgn0036126 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001017319.1 |
Gene: | tef / 550073 |
XenbaseID: | XB-GENE-962732 |
Length: | 296 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 35/66 - (53%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 DPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE 89
|..|..:|.|||.|.:|:|:..:....:...|...|.|:|.||:.::....|.:|..|::|.:.|
Frog 220 DEKYWTRRNKNNVAAKRSRDARRLKENQITVRAAFLEKENSALRSEVADLRKELSKCRNIISKYE 284
Fly 90 K 90
|
Frog 285 K 285
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.