DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and tef

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001017319.1 Gene:tef / 550073 XenbaseID:XB-GENE-962732 Length:296 Species:Xenopus tropicalis


Alignment Length:66 Identity:21/66 - (31%)
Similarity:35/66 - (53%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE 89
            |..|..:|.|||.|.:|:|:..:....:...|...|.|:|.||:.::....|.:|..|::|.:.|
 Frog   220 DEKYWTRRNKNNVAAKRSRDARRLKENQITVRAAFLEKENSALRSEVADLRKELSKCRNIISKYE 284

  Fly    90 K 90
            |
 Frog   285 K 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 17/57 (30%)
coiled coil 25..83 CDD:269841 17/57 (30%)
tefNP_001017319.1 T4BSS_DotH_IcmK 132..>184 CDD:289093
bZIP_HLF 219..278 CDD:269843 17/57 (30%)
coiled coil 220..278 CDD:269843 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.