DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and cebpg

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001016443.1 Gene:cebpg / 549197 XenbaseID:XB-GENE-919758 Length:137 Species:Xenopus tropicalis


Alignment Length:97 Identity:28/97 - (28%)
Similarity:54/97 - (55%) Gaps:5/97 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIE 72
            |...||||............|:.:|::||.||:::|.|:|:.|::..:|::.|:::|:.|:.:|:
 Frog    36 ATPPSKNSKKGQRLDRGSEEYRLRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIK 100

  Fly    73 TSEKHISTLRDLIIQGEKTEDGHRIIQEILAE 104
            ...|.:|.|:||.:     |..|.:...:..|
 Frog   101 LLTKELSVLKDLFL-----EHAHNLADNVQPE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 18/58 (31%)
coiled coil 25..83 CDD:269841 18/57 (32%)
cebpgNP_001016443.1 bZIP_CEBPG 53..111 CDD:269861 18/57 (32%)
coiled coil 53..111 CDD:269861 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.