DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and cebpa

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001011044.1 Gene:cebpa / 496454 XenbaseID:XB-GENE-853397 Length:297 Species:Xenopus tropicalis


Alignment Length:86 Identity:22/86 - (25%)
Similarity:46/86 - (53%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDA 66
            |:...:::|:.....|..........|:.:|::||.||:::|:|.|....|.:.::.:|..:||.
 Frog   198 PSSSISSSSSENRGKSKKWVDKSSSEYRVRRERNNIAVRKSRDKAKMRNAETQHKVIELSTENDK 262

  Fly    67 LKVQIETSEKHISTLRDLIIQ 87
            |:.::|...:.:.|||.:..|
 Frog   263 LRKRVEQLSRELETLRGIFRQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 17/58 (29%)
coiled coil 25..83 CDD:269841 17/57 (30%)
cebpaNP_001011044.1 bZIP_CEBPB 214..284 CDD:269860 19/70 (27%)
coiled coil 221..282 CDD:269860 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.