DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and slbo

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001286836.1 Gene:slbo / 37889 FlyBaseID:FBgn0005638 Length:449 Species:Drosophila melanogaster


Alignment Length:99 Identity:28/99 - (28%)
Similarity:52/99 - (52%) Gaps:21/99 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKH 77
            |:|:..:...||:  |:.:|::||.||:::|||.|..:.|.::|:..|.|:.|||          
  Fly   353 KHSNKHVDKGTDE--YRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDAL---------- 405

  Fly    78 ISTLRDLIIQGEKTED---GHRIIQEILAEPDPD 108
               :|.|   ||.|.:   ..:|..:::...:|:
  Fly   406 ---IRQL---GEMTNELQLHKQIYMQLMNHANPE 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 18/58 (31%)
coiled coil 25..83 CDD:269841 17/57 (30%)
slboNP_001286836.1 bZIP_CEBP 362..420 CDD:269841 24/75 (32%)
coiled coil 363..420 CDD:269841 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.