DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and Mabi

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_609624.1 Gene:Mabi / 34727 FlyBaseID:FBgn0032493 Length:206 Species:Drosophila melanogaster


Alignment Length:143 Identity:33/143 - (23%)
Similarity:59/143 - (41%) Gaps:46/143 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAKKRTAASTSKNSDSPLSP------------HTD----------DPAYKEKRKKNNEAVQRTR 43
            :|.::|..:|:|..|....||            |.:          .|..:|:|.||..|.:.:|
  Fly    64 LPKRRRLGSSSSSVSYQSASPIITEAIQDIFKYHVNMVRKFPKKERSPKDQERRNKNTIACRMSR 128

  Fly    44 EKTKKSAEERKKRIDDLRKQ-------NDALKV--QIETSEKHISTLRDLIIQGEKTEDGHRIIQ 99
                     |||:.|||:.:       ::.||:  |...:..:::.|:.|:    |.|| |.::.
  Fly   129 ---------RKKKFDDLQIEQQYKECSDEHLKIAEQSLRARVYLNHLKQLV----KQED-HPLVS 179

  Fly   100 EILAEPDPDPKDN 112
            . ...|:.:.|.|
  Fly   180 S-RRVPEENTKSN 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 17/77 (22%)
coiled coil 25..83 CDD:269841 17/66 (26%)
MabiNP_609624.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.