DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and Hlf

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001390914.1 Gene:Hlf / 217082 MGIID:96108 Length:296 Species:Mus musculus


Alignment Length:104 Identity:22/104 - (21%)
Similarity:43/104 - (41%) Gaps:15/104 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAKKRTAASTSKNSDSPLSPH---------------TDDPAYKEKRKKNNEAVQRTREKTKKSA 50
            :|.::.......|.|:..|.|.               ..|..|..:|:|||.|.:|:|:..:...
Mouse   187 IPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKQDDKYWARRRKNNMAAKRSRDARRLKE 251

  Fly    51 EERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGE 89
            .:...|...|.|:|.||:.::....|.:...::::.:.|
Mouse   252 NQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 16/58 (28%)
coiled coil 25..83 CDD:269841 16/57 (28%)
HlfNP_001390914.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..76
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..149
bZIP_HLF 226..284 CDD:269843 16/57 (28%)
coiled coil 226..284 CDD:269843 16/57 (28%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 228..248 8/19 (42%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 249..256 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.