DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Irbp18 and Nfil3

DIOPT Version :9

Sequence 1:	NP_001261698.1	Gene:	Irbp18 / 39243	FlyBaseID:	FBgn0036126	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	NP_059069.1	Gene:	Nfil3 / 18030	MGIID:	109495	Length:	462	Species:	Mus musculus

Alignment Length:	68	Identity:	22/68 - (32%)
Similarity:	37/68 - (54%)	Gaps:	2/68 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     4 KKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALK 68
            |.:::|...|....|  ....|..|.|||:|||||.:|:|||.:.:....:.::..|.::|..||
Mouse    54 KNKSSACRRKREFIP--DEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLK 116

  Fly    69 VQI 71
            .::
Mouse   117 AEL 119

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Irbp18	NP_001261698.1	bZIP_CEBP	24..83	CDD:269841	18/48 (38%)
Irbp18	NP_001261698.1	coiled coil	25..83	CDD:269841	18/47 (38%)
Nfil3	NP_059069.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..22
		bZIP_NFIL3	72..131	CDD:269842	18/48 (38%)
		coiled coil	76..127	CDD:269842	17/44 (39%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	79..95		11/15 (73%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	99..106		0/6 (0%)
		Vert_IL3-reg_TF	130..461	CDD:368956
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	188..214
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	259..298
		Necessary for transcriptional repression and sufficient for interaction with PER2. /evidence=ECO:0000269\|PubMed:17274955	281..420
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3119
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810