DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and atf-2

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_495861.1 Gene:atf-2 / 174399 WormBaseID:WBGene00000220 Length:401 Species:Caenorhabditis elegans


Alignment Length:78 Identity:24/78 - (30%)
Similarity:43/78 - (55%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 STSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETS 74
            |.|.:|:...:.....|.|.::|::||||.:|.|...:...|.|.:|:..|..:|:.|:.||||.
 Worm   314 SPSHSSEDHSNYSNKSPQYVDRRRRNNEAAKRCRANRRAVFEYRSRRVQLLEGENEDLRTQIETL 378

  Fly    75 EKHISTLRDLIIQ 87
            :..|:..:.::.|
 Worm   379 KAEIAHFKSVLAQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 20/58 (34%)
coiled coil 25..83 CDD:269841 20/57 (35%)
atf-2NP_495861.1 bZIP_NFIL3 53..>100 CDD:269842
bZIP_HLF 328..386 CDD:269843 20/57 (35%)
coiled coil 329..386 CDD:269843 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.