DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and atf-2

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_495861.1 Gene:atf-2 / 174399 WormBaseID:WBGene00000220 Length:401 Species:Caenorhabditis elegans


Alignment Length:78 Identity:24/78 - (30%)
Similarity:43/78 - (55%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 STSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETS 74
            |.|.:|:...:.....|.|.::|::||||.:|.|...:...|.|.:|:..|..:|:.|:.||||.
 Worm   314 SPSHSSEDHSNYSNKSPQYVDRRRRNNEAAKRCRANRRAVFEYRSRRVQLLEGENEDLRTQIETL 378

  Fly    75 EKHISTLRDLIIQ 87
            :..|:..:.::.|
 Worm   379 KAEIAHFKSVLAQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 20/58 (34%)
coiled coil 25..83 CDD:269841 20/57 (35%)
atf-2NP_495861.1 bZIP_NFIL3 53..>100 CDD:269842
bZIP_HLF 328..386 CDD:269843 20/57 (35%)
coiled coil 329..386 CDD:269843 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.