DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and cebp-2

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_871835.1 Gene:cebp-2 / 172319 WormBaseID:WBGene00016754 Length:100 Species:Caenorhabditis elegans


Alignment Length:104 Identity:32/104 - (30%)
Similarity:58/104 - (55%) Gaps:14/104 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIE 72
            :.:..:|:..|.....||  |..|||:|||||.|||:|.::...:..:::|:|:|:|:.|:.::|
 Worm     2 SGNRKRNTSEPREDDEDD--YSTKRKRNNEAVNRTRQKKRQEENDTAEKVDELKKENETLERKVE 64

  Fly    73 TSEKHISTLRDLIIQGEKTE--DGHRIIQEILAEPDPDP 109
            ..:|.:|.|:::.:...|.:  ||          |.|.|
 Worm    65 QLQKELSFLKEMFMAYAKNDGNDG----------PPPPP 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 24/58 (41%)
coiled coil 25..83 CDD:269841 23/57 (40%)
cebp-2NP_871835.1 bZIP_CEBP 16..75 CDD:269841 24/60 (40%)
coiled coil 20..71 CDD:269841 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3985
Isobase 1 0.950 - 0 Normalized mean entropy S4384
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto19273
orthoMCL 1 0.900 - - OOG6_108546
Panther 1 1.100 - - LDO PTHR23334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.