DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and DBP

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001343.2 Gene:DBP / 1628 HGNCID:2697 Length:325 Species:Homo sapiens


Alignment Length:138 Identity:27/138 - (19%)
Similarity:45/138 - (32%) Gaps:55/138 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKKRTAASTSKNSDSPLSPHT--------DDPA-------------------------------- 27
            |....|..||:::.||:.|.|        .|||                                
Human   178 ASGHRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMK 242

  Fly    28 ---------------YKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKH 77
                           |..:|.|||||.:|:|:..:....:...|...|.|:|..|:.::....:.
Human   243 KARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQE 307

  Fly    78 ISTLRDLI 85
            :|..|.::
Human   308 LSHYRAVL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 18/105 (17%)
coiled coil 25..83 CDD:269841 18/104 (17%)
DBPNP_001343.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..200 8/21 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..255 0/25 (0%)
bZIP_HLF 254..313 CDD:269843 15/58 (26%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 9/21 (43%)
coiled coil 258..309 CDD:269843 14/50 (28%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.