DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and cebpd

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_571962.1 Gene:cebpd / 140817 ZFINID:ZDB-GENE-020111-4 Length:280 Species:Danio rerio


Alignment Length:112 Identity:26/112 - (23%)
Similarity:54/112 - (48%) Gaps:25/112 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAKKRTAASTSKN---SDSPLSPHTDD----------------------PAYKEKRKKNNEAVQ 40
            :|::....|.||.|   :..|..|.|.:                      |.|:::|::||.||:
Zfish   152 LPSQIEACAQTSVNFMHTGQPTPPTTPEPEPVAHRRPGKEKGKKNVDRHSPEYRQRRERNNIAVR 216

  Fly    41 RTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQ 87
            ::|:|.|:...:.::::.:|..:|:.|...|:...:.:|:||:...|
Zfish   217 KSRDKAKQRNLDMQQKMIELGAENERLHKTIDQLTRELSSLRNFFKQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 16/80 (20%)
coiled coil 25..83 CDD:269841 16/79 (20%)
cebpdNP_571962.1 bZIP 198..262 CDD:304365 17/63 (27%)
coiled coil 204..255 CDD:269834 13/50 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.