DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and cebpg

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_571961.1 Gene:cebpg / 140816 ZFINID:ZDB-GENE-020111-5 Length:163 Species:Danio rerio


Alignment Length:97 Identity:28/97 - (28%)
Similarity:59/97 - (60%) Gaps:9/97 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKV 69
            |.||.|..|.|:.    ..|...|:::|::||.||:::|.::|:.|::.::|:::|:::|:.|:.
Zfish    53 KATAPSKMKKSNM----DKDSDEYRQRRERNNLAVKKSRMRSKQKAQDTQQRVNELKEENERLEA 113

  Fly    70 QIETSEKHISTLRDLIIQGEKTEDGHRIIQEI 101
            :|:...|.:|.|:||.:     |..|.:...:
Zfish   114 KIKLLSKELSVLKDLFL-----EHAHNLADNV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 18/58 (31%)
coiled coil 25..83 CDD:269841 17/57 (30%)
cebpgNP_571961.1 bZIP_CEBPG 67..127 CDD:269861 18/59 (31%)
coiled coil 69..127 CDD:269861 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto41154
orthoMCL 1 0.900 - - OOG6_108546
Panther 1 1.100 - - LDO PTHR23334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.