Sequence 1: | NP_001261698.1 | Gene: | Irbp18 / 39243 | FlyBaseID: | FBgn0036126 | Length: | 113 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571961.1 | Gene: | cebpg / 140816 | ZFINID: | ZDB-GENE-020111-5 | Length: | 163 | Species: | Danio rerio |
Alignment Length: | 97 | Identity: | 28/97 - (28%) |
---|---|---|---|
Similarity: | 59/97 - (60%) | Gaps: | 9/97 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKV 69
Fly 70 QIETSEKHISTLRDLIIQGEKTEDGHRIIQEI 101 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Irbp18 | NP_001261698.1 | bZIP_CEBP | 24..83 | CDD:269841 | 18/58 (31%) |
coiled coil | 25..83 | CDD:269841 | 17/57 (30%) | ||
cebpg | NP_571961.1 | bZIP_CEBPG | 67..127 | CDD:269861 | 18/59 (31%) |
coiled coil | 69..127 | CDD:269861 | 17/57 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | oto41154 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_108546 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR23334 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4506 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.800 |