DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and Ddit3

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_030100727.1 Gene:Ddit3 / 13198 MGIID:109247 Length:182 Species:Mus musculus


Alignment Length:87 Identity:20/87 - (22%)
Similarity:44/87 - (50%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SKNSDSPLSPHT-----------DDPAYKEKRKKNNEAVQRT-REKTKKSAEERKKRIDDLRKQN 64
            ::.|.||.||.:           ::.....|||::.:...|. :::.|:..:|.::::..|.::|
Mouse    87 TRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAEEN 151

  Fly    65 DALKVQIETSEKHISTLRDLII 86
            :.||.:||...:.:.|.|..:|
Mouse   152 ERLKQEIERLTREVETTRRALI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 13/59 (22%)
coiled coil 25..83 CDD:269841 13/58 (22%)
Ddit3XP_030100727.1 BRLZ 114..174 CDD:197664 15/60 (25%)
coiled coil 116..166 CDD:269834 12/49 (24%)

Return to query results.
Submit another query.