powered by:
Protein Alignment Irbp18 and Dbp
DIOPT Version :9
Sequence 1: | NP_001261698.1 |
Gene: | Irbp18 / 39243 |
FlyBaseID: | FBgn0036126 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_058670.2 |
Gene: | Dbp / 13170 |
MGIID: | 94866 |
Length: | 325 |
Species: | Mus musculus |
Alignment Length: | 133 |
Identity: | 26/133 - (19%) |
Similarity: | 44/133 - (33%) |
Gaps: | 55/133 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 AASTSKNSDSPLSPHT--------DDPA------------------------------------- 27
|..||:::.||:.|.| .|||
Mouse 183 AGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKV 247
Fly 28 ----------YKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLR 82
|..:|.|||||.:|:|:..:....:...|...|.|:|..|:.::....:.:|..|
Mouse 248 QVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYR 312
Fly 83 DLI 85
.::
Mouse 313 AVL 315
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3119 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.