DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and Dbp

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_058670.2 Gene:Dbp / 13170 MGIID:94866 Length:325 Species:Mus musculus


Alignment Length:133 Identity:26/133 - (19%)
Similarity:44/133 - (33%) Gaps:55/133 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AASTSKNSDSPLSPHT--------DDPA------------------------------------- 27
            |..||:::.||:.|.|        .|||                                     
Mouse   183 AGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPIMKKARKV 247

  Fly    28 ----------YKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLR 82
                      |..:|.|||||.:|:|:..:....:...|...|.|:|..|:.::....:.:|..|
Mouse   248 QVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQEVVAVRQELSHYR 312

  Fly    83 DLI 85
            .::
Mouse   313 AVL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 18/105 (17%)
coiled coil 25..83 CDD:269841 18/104 (17%)
DbpNP_058670.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..203 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..256 0/25 (0%)
bZIP_HLF 254..313 CDD:269843 15/58 (26%)
coiled coil 255..313 CDD:269843 15/57 (26%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 9/21 (43%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.