DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Irbp18 and Cebpd

DIOPT Version :9

Sequence 1:	NP_001261698.1	Gene:	Irbp18 / 39243	FlyBaseID:	FBgn0036126	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	NP_031705.3	Gene:	Cebpd / 12609	MGIID:	103573	Length:	268	Species:	Mus musculus

Alignment Length:	62	Identity:	18/62 - (29%)
Similarity:	41/62 - (66%)	Gaps:	0/62 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    21 PHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLR 82
            |....|.|:::|::||.||:::|:|.|:..:|.::::.:|..:|:.|..::|...:.::.||
Mouse   187 PDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLR 248

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Irbp18	NP_001261698.1	bZIP_CEBP	24..83	CDD:269841	17/59 (29%)
Irbp18	NP_001261698.1	coiled coil	25..83	CDD:269841	17/58 (29%)
Cebpd	NP_031705.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..48
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	97..132
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	152..219		11/31 (35%)
		bZIP_CEBPD	188..252	CDD:269862	17/61 (28%)
		coiled coil	191..249	CDD:269862	17/58 (29%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	195..222		9/26 (35%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	226..254		6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm43756
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R4506
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.940