DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and Cebpb

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_034013.1 Gene:Cebpb / 12608 MGIID:88373 Length:296 Species:Mus musculus


Alignment Length:86 Identity:27/86 - (31%)
Similarity:48/86 - (55%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDA 66
            |||.:...:..|.||.          ||.:|::||.||:::|:|.|....|.:.::.:|..:|:.
Mouse   209 PAKAKAKKTVDKLSDE----------YKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENER 263

  Fly    67 LKVQIETSEKHISTLRDLIIQ 87
            |:.::|...:.:||||:|..|
Mouse   264 LQKKVEQLSRELSTLRNLFKQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 18/58 (31%)
coiled coil 25..83 CDD:269841 18/57 (32%)
CebpbNP_034013.1 Required for Lys-133 sumoylation. /evidence=ECO:0000250|UniProtKB:P17676 1..22
Required for MYC transcriptional repression. /evidence=ECO:0000269|PubMed:16585579 22..104
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..199
bZIP_CEBPB 215..285 CDD:269860 24/80 (30%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..246 9/19 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 248..255 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43756
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.