DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and Nfil3

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_446179.2 Gene:Nfil3 / 114519 RGDID:620972 Length:462 Species:Rattus norvegicus


Alignment Length:68 Identity:22/68 - (32%)
Similarity:37/68 - (54%) Gaps:2/68 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALK 68
            |.:::|...|....|  ....|..|.|||:|||||.:|:|||.:.:....:.::..|.::|..||
  Rat    54 KNKSSACRRKREFIP--DEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLK 116

  Fly    69 VQI 71
            .::
  Rat   117 AEL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 18/48 (38%)
coiled coil 25..83 CDD:269841 18/47 (38%)
Nfil3NP_446179.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
bZIP_NFIL3 72..131 CDD:269842 18/48 (38%)
coiled coil 73..131 CDD:269842 18/47 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..95 11/15 (73%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 99..106 0/6 (0%)
Vert_IL3-reg_TF 130..461 CDD:368956
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..298
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.