powered by:
Protein Alignment Irbp18 and cebp1
DIOPT Version :9
Sequence 1: | NP_001261698.1 |
Gene: | Irbp18 / 39243 |
FlyBaseID: | FBgn0036126 |
Length: | 113 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571912.1 |
Gene: | cebp1 / 114453 |
ZFINID: | ZDB-GENE-010611-1 |
Length: | 169 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 20/74 - (27%) |
Similarity: | 42/74 - (56%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 DDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQG 88
|...|:::|::||.||:::|:|.::..:..::|...|:.:|..|:|.|:.....:..||..:.|.
Zfish 96 DSAEYRQRRERNNIAVRKSRDKARRRIQMTQQRALQLQDENHRLQVHIQRLLHEVEALRHYLSQR 160
Fly 89 --EKTEDGH 95
:.|.:.|
Zfish 161 HLQDTSEEH 169
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.