DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Irbp18 and Cebpe

DIOPT Version :9

Sequence 1:	NP_001261698.1	Gene:	Irbp18 / 39243	FlyBaseID:	FBgn0036126	Length:	113	Species:	Drosophila melanogaster
Sequence 2:	NP_997014.1	Gene:	Cebpe / 110794	MGIID:	103572	Length:	281	Species:	Mus musculus

Alignment Length:	79	Identity:	21/79 - (26%)
Similarity:	45/79 - (56%)	Gaps:	8/79 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 SPLSP--------HTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDALKVQIET 73
            ||..|        :.|...|:.:|::||.||:::|:|.|:...|.::::.:...:|:.|:.:::.
Mouse   188 SPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYMAENERLRNRVDQ 252

  Fly    74 SEKHISTLRDLIIQ 87
            ..:.:.|||:|..|
Mouse   253 LTQELDTLRNLFRQ 266

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Irbp18	NP_001261698.1	bZIP_CEBP	24..83	CDD:269841	15/58 (26%)
Irbp18	NP_001261698.1	coiled coil	25..83	CDD:269841	14/57 (25%)
Cebpe	NP_997014.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..30
		bZIP_CEBPE	202..262	CDD:269863	15/59 (25%)
		coiled coil	204..262	CDD:269863	14/57 (25%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	208..245		10/36 (28%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	246..267		6/21 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3119
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	1	1.000	-	-		otm43756
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810