DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and CEBPE

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001796.2 Gene:CEBPE / 1053 HGNCID:1836 Length:281 Species:Homo sapiens


Alignment Length:98 Identity:27/98 - (27%)
Similarity:52/98 - (53%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAKKRTAA---STSKNSDSPLSP--------HTDDPAYKEKRKKNNEAVQRTREKTKKSAEERK 54
            :.|...|||   |....:.||..|        :.|...|:.:|::||.||:::|:|.|:...|.:
Human   169 LKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQ 233

  Fly    55 KRIDDLRKQNDALKVQIETSEKHISTLRDLIIQ 87
            :::.:...:|:.|:.::|...:.:.|||:|..|
Human   234 QKVLEYMAENERLRSRVEQLTQELDTLRNLFRQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 16/58 (28%)
coiled coil 25..83 CDD:269841 15/57 (26%)
CEBPENP_001796.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PHA03247 <62..192 CDD:223021 7/22 (32%)
bZIP_CEBPE 202..262 CDD:269863 16/59 (27%)
coiled coil 204..262 CDD:269863 15/57 (26%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..228 8/19 (42%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 230..237 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.