DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and CEBPB

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_005185.2 Gene:CEBPB / 1051 HGNCID:1834 Length:345 Species:Homo sapiens


Alignment Length:86 Identity:27/86 - (31%)
Similarity:50/86 - (58%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDA 66
            ||..:..:...|..|.    |:|:  ||.:|::||.||:::|:|.|....|.:.::.:|..:|:.
Human   254 PAPSQVKSKAKKTVDK----HSDE--YKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENER 312

  Fly    67 LKVQIETSEKHISTLRDLIIQ 87
            |:.::|...:.:||||:|..|
Human   313 LQKKVEQLSRELSTLRNLFKQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 19/58 (33%)
coiled coil 25..83 CDD:269841 18/57 (32%)
CEBPBNP_005185.2 Required for Lys-174 sumoylation 1..24
Required for MYC transcriptional repression. /evidence=ECO:0000250|UniProtKB:P28033 24..135
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..116
9aaTAD 116..124
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..178
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..271 4/20 (20%)
bZIP_CEBPB 264..334 CDD:269860 25/76 (33%)
coiled coil 271..332 CDD:269860 21/62 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 275..295 9/19 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 297..304 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.