DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and CEBPA

DIOPT Version :9

Sequence 1:NP_001261698.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001274353.1 Gene:CEBPA / 1050 HGNCID:1833 Length:393 Species:Homo sapiens


Alignment Length:85 Identity:26/85 - (30%)
Similarity:47/85 - (55%) Gaps:14/85 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQNDAL 67
            |||    |..|||:.          |:.:|::||.||:::|:|.|:...|.::::.:|...||.|
Human   309 AKK----SVDKNSNE----------YRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRL 359

  Fly    68 KVQIETSEKHISTLRDLIIQ 87
            :.::|...:.:.|||.:..|
Human   360 RKRVEQLSRELDTLRGIFRQ 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_001261698.1 bZIP_CEBP 24..83 CDD:269841 17/58 (29%)
coiled coil 25..83 CDD:269841 17/57 (30%)
CEBPANP_001274353.1 bZIP_CEBPA 315..375 CDD:269859 20/69 (29%)
coiled coil 317..375 CDD:269859 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41706
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4506
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.