DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Irbp18 and Nfilz

DIOPT Version :10

Sequence 1:NP_648434.1 Gene:Irbp18 / 39243 FlyBaseID:FBgn0036126 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001388168.1 Gene:Nfilz / 100042953 MGIID:3782301 Length:278 Species:Mus musculus


Alignment Length:72 Identity:21/72 - (29%)
Similarity:36/72 - (50%) Gaps:18/72 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSAEERKKRIDDLRKQND 65
            ||.:|:                  |..|.|||:|||||.:|:|||.:.:....:.|:..|.::|.
Mouse    35 MPEEKK------------------DTVYWEKRRKNNEAAKRSREKRRLNDVAIEGRLAMLLEENA 81

  Fly    66 ALKVQIE 72
            .|:.:::
Mouse    82 ILRAELQ 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Irbp18NP_648434.1 bZIP_CEBP 24..83 CDD:269841 18/49 (37%)
coiled coil 25..83 CDD:269841 18/48 (38%)
NfilzNP_001388168.1 bZIP_NFIL3 40..97 CDD:269842 18/67 (27%)
coiled coil 41..97 CDD:269842 18/48 (38%)

Return to query results.
Submit another query.