DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and YPK2

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_013822.1 Gene:YPK2 / 855130 SGDID:S000004710 Length:677 Species:Saccharomyces cerevisiae


Alignment Length:671 Identity:204/671 - (30%)
Similarity:304/671 - (45%) Gaps:148/671 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KNHQHPRE--------SESLAYEEPDQMVRNHL---NGQLVANGNGKT--RKNSNSETMTNGKKS 72
            |||.|..|        :|:|........:||..   |...:.|.|.|.  ||.|.|.|.|.|..|
Yeast    48 KNHNHEHEHHIRKINTNETLPSSLSSPKLRNDASFKNPSGIGNDNSKASERKASQSSTETQGPSS 112

  Fly    73 K--LNTEGSGSGSGKTLNY------------------NNNNNNNNSISATNGQ---YTNSSSKTT 114
            :  |.|....||...||.:                  .:::|:.:.::|...|   |......:.
Yeast   113 ESGLMTVKVYSGKDFTLPFPITSNSTILQKLLSSGILTSSSNDASEVAAIMRQLPRYKRVDQDSA 177

  Fly   115 SASARDYTYRETISPPTPPSPPTTNVADIVCISDAESEDGRDPEREYYDQDMEEDEPNGIEIDES 179
            .....|..:.....|.:...|.:||.:.::                |:.          ||.|.|
Yeast   178 GEGLIDRAFATKFIPSSILLPGSTNSSPLL----------------YFT----------IEFDNS 216

  Fly   180 SSSLSKAKSNNAAAAAAAAAAAAAAAASKASS---------------STTPSYAMPTSN------ 223
            .:::|           ...........:|.|:               :..||..:|:.|      
Yeast   217 ITTIS-----------PDMGTMEQPVFNKISTFDVTRKLRFLKIDVFARIPSLLLPSKNWQQEIG 270

  Fly   224 -------------STPLDLDNEAHQRDLEAVTDLKYYVKLYS----------------------- 252
                         :|..|:..::....|....|....::||:                       
Yeast   271 EQDEVLKEILKKINTNQDIHLDSFHLPLNLKIDSAAQIRLYNHHWISLERGYGKLNITVDYKPSK 335

  Fly   253 DEAVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVL 317
            ::.:|::||.:::|:|.|::|:|..|||   .|..|:||:|.|.|..:|.|.:.. ||..||.||
Yeast   336 NKPLSIDDFDLLKVIGKGSFGKVMQVRK---KDTQKIYALKALRKAYIVSKCEVT-HTLAERTVL 396

  Fly   318 EAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQ 382
            ..:. .||:|.|.::|||..||||||.|.||||||.||.|...|..:|.|.||||::.||:.||:
Yeast   397 ARVD-CPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHK 460

  Fly   383 LGIIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSA 447
            |.:||||:|.||||||.:|||.|.||||.|:...:|: :..:||||.||:||||:.  ..|:...
Yeast   461 LDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDND-KTDTFCGTPEYLAPEILL--GQGYTKT 522

  Fly   448 VDWWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMI-PSSFSANARDFVLKMLEKNPK 511
            ||||::|:|.:|::||..|:...:..|...:|     .:||:: |..|...|:|.::.:|.::|.
Yeast   523 VDWWTLGILLYEMMTGLPPYYDENVPVMYKKI-----LQQPLLFPDGFDPAAKDLLIGLLSRDPS 582

  Fly   512 RRLGGNHRDASEIKEHPFFNGINWQELRTKRRKAPYKPTLTAEDDVQNFSNEFTDQVPEDPECD- 575
            ||||.|..|  ||:.||||..|:|::|..|....||||.:.:|.|..||..|||.:.|.|...| 
Yeast   583 RRLGVNGTD--EIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDE 645

  Fly   576 -APPSRIRLFRGYTYVAPEHL 595
             ...|..:.|.|:||:..|.|
Yeast   646 YLSASIQKQFGGWTYIGDEQL 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 121/269 (45%)
STKc_MSK_N 266..533 CDD:270735 122/267 (46%)
S_TK_X 532..591 CDD:214529 23/60 (38%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
YPK2NP_013822.1 YPK1_N_like 114..339 CDD:212165 33/261 (13%)
PKc_like 349..660 CDD:419665 143/325 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.