DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and AT3G19100

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_188541.1 Gene:AT3G19100 / 821445 AraportID:AT3G19100 Length:599 Species:Arabidopsis thaliana


Alignment Length:519 Identity:120/519 - (23%)
Similarity:199/519 - (38%) Gaps:89/519 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 KEQPMIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQELRTKRRKAPYKP 549
            |..|..|       :|.||:..:..|........|.:..:|..|||........|.:|.|     
plant    13 KPNPYAP-------KDAVLQNDDSTPAHPGKSPVRSSPAVKASPFFPFYTPSPARHRRNK----- 65

  Fly   550 TLTAEDDVQNFSNEFTD-QVPEDPECDAPPSRIRLFRGY--------TYVAPEHLEQMRRDNHCE 605
               :.|.....|...|. .:.:......|||..|..|..        ....|...:|...:...|
plant    66 ---SRDGGGGESKSVTSTPLRQLARAFHPPSPARHIRDVLRRRKEKKEAALPAARQQKEEEEREE 127

  Fly   606 IQY-----FNTGLQNIPCRPDDLELGTRTSNGAYG-TC--HFVVDSSTDLVFLAKIIPLSKFRPS 662
            :..     |:..||:      .:|||.....|.:| ||  .|......|.....|:||.||...:
plant   128 VGLDKRFGFSKELQS------RIELGEEIGRGHFGYTCSAKFKKGELKDQEVAVKVIPKSKMTSA 186

  Fly   663 ----EVDALISCALDTTNHKNIVSYHGTFREKCETWIVMEYLSGPELTASI-----RMDEDSCRE 718
                :|...:......:.|:|:|.::..|.:....:||||...|.||...|     :..||..:.
plant   187 ISIEDVRREVKILRALSGHQNLVQFYDAFEDNANVYIVMELCGGGELLDRILARGGKYSEDDAKA 251

  Fly   719 IFLQLVMAVRHIHSKHFIHGDLKPENIMFENREDRT-VKLIDFGSACYNNRFKSWKDKPRYTLD- 781
            :.:|::..|...|.:..:|.||||||.::.::|:.: :|:||||.:.:        .:|...|: 
plant   252 VLIQILNVVAFCHLQGVVHRDLKPENFLYTSKEENSMLKVIDFGLSDF--------VRPDERLND 308

  Fly   782 ------YAPPEMLADANLVTYSPAVDIYGLGATLYTMLVGHRPYRQNEDDVDHSAAAHHELRKRM 840
                  |..||:|..    :|:...|::.:|...|.:|.|.||:....:.....|....:     
plant   309 IVGSAYYVAPEVLHR----SYTTEADVWSIGVIAYILLCGSRPFWARTESGIFRAVLKAD----- 364

  Fly   841 RRGTFNQRSMRWESASPAFRHLVSWCLQRDPADRPTLSDILDSEWLQ-YGSNDPDVDIILPQQMV 904
              .:|::..  |.|.|...:..|...|.:||..|.|.|..|...|:. |...|...||::.:|:.
plant   365 --PSFDEPP--WPSLSFEAKDFVKRLLYKDPRKRMTASQALMHPWIAGYKKIDIPFDILIFKQIK 425

  Fly   905 VDLSEDTMEQP-----TGGMFDDQ---QQLEFMHDKSAEDEGITLVSEPM----DTTVATHESR 956
            ..|...::.:.     :..:..|:   .:.:|.|....::..|||.|..:    :.|.|..|||
plant   426 AYLRSSSLRKAALMALSKTLTTDELLYLKAQFAHLAPNKNGLITLDSIRLALATNATEAMKESR 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 10/44 (23%)
STKc_MSK_N 266..533 CDD:270735 12/47 (26%)
S_TK_X 532..591 CDD:214529 11/67 (16%)
S_TKc 632..886 CDD:214567 69/273 (25%)
PKc_like 632..885 CDD:304357 69/272 (25%)
AT3G19100NP_188541.1 STKc_CAMK 145..405 CDD:270687 72/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.