DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and S6K2

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_001327294.1 Gene:S6K2 / 820019 AraportID:AT3G08720 Length:471 Species:Arabidopsis thaliana


Alignment Length:429 Identity:170/429 - (39%)
Similarity:242/429 - (56%) Gaps:43/429 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 NAAAAAAAAAAAAAAAASKASSSTTPSYAMPTSNSTPLDLDNEAHQRDLEAVTDLKYYVKLYS-- 252
            |:..|...|....|...|::.|...||  :..|:|..:   |:...|:.|...||...|:..|  
plant    52 NSEEACDVAYDEPAVVYSRSHSLVGPS--LVVSHSLKM---NKLTLRETEDSVDLVECVEGESIK 111

  Fly   253 --DE------------------AVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNK 297
              ||                  .|.:.||::::|:|.||:|:|:.|||   .|..::|||||:.|
plant   112 ENDEFSGNDDTDSEKSPEEVSGVVGIEDFEVLKVVGQGAFGKVYQVRK---KDTSEIYAMKVMRK 173

  Fly   298 ITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFE 362
            ..:|:|.. ||:.|.||.:|..|. :||:|.|.|:||:..:|||||||.|||.||..|||...|.
plant   174 DKIVEKNH-AEYMKAERDILTKID-HPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFR 236

  Fly   363 ESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCG 427
            |...|||.||:|.|:..||:.||::||:|.||||:|.:||::|:||||:|  ..|...|::|.||
plant   237 EDLARVYTAEIVSAVSHLHEKGIMHRDLKPENILMDVDGHVMLTDFGLAK--EFEENTRSNSMCG 299

  Fly   428 TLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPS 492
            |.|||||||:|  ..|||.|.||||||:|.:|:|||..||..|.|::||     :|.|::..:|.
plant   300 TTEYMAPEIVR--GKGHDKAADWWSVGILLYEMLTGKPPFLGSKGKIQQ-----KIVKDKIKLPQ 357

  Fly   493 SFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQELRTKRRKAPYKPTLTAEDDV 557
            ..|..|...:..:|:|.|:||||.....|.|||:|.:|..|||::|..:..:..:||.::....:
plant   358 FLSNEAHALLKGLLQKEPERRLGSGPSGAEEIKKHKWFKAINWKKLEAREVQPSFKPAVSGRQCI 422

  Fly   558 QNFSNEFTDQVPEDPECDAPPS--RIRLFRGYTYVAPEH 594
            .||...:||....|....:|.|  :...|..:|||.|.|
plant   423 ANFDKCWTDMSVLDSPASSPNSDAKANPFTNFTYVRPPH 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 129/268 (48%)
STKc_MSK_N 266..533 CDD:270735 129/266 (48%)
S_TK_X 532..591 CDD:214529 16/60 (27%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
S6K2NP_001327294.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.