DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and RPS6KB1

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_003152.1 Gene:RPS6KB1 / 6198 HGNCID:10436 Length:525 Species:Homo sapiens


Alignment Length:454 Identity:172/454 - (37%)
Similarity:253/454 - (55%) Gaps:52/454 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 DGRDPERE----YYDQDMEEDEPNGIEID-ESSSSLSKAKSNNAAAAAAAAAAAAAAAASKASSS 212
            |.||.|.|    .:|.|:::.|..|.|.: |....|:::..:....                   
Human    15 DFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG------------------- 60

  Fly   213 TTPSYAMPTSNSTPLDLDNEAHQRDLEAVTDLKYYVKLYSDEAVSLNDFKIIRVLGTGAYGRVFL 277
               .|.:...:....::...:..|               ..|.:....|:::||||.|.||:||.
Human    61 ---PYELGMEHCEKFEISETSVNR---------------GPEKIRPECFELLRVLGKGGYGKVFQ 107

  Fly   278 VRKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLV 342
            |||:|..:.||::|||||.|..:|:..|...|||.||.:||.: ::||:|.|.||||:..||||:
Human   108 VRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEV-KHPFIVDLIYAFQTGGKLYLI 171

  Fly   343 LDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLDGEGHIVLSD 407
            |::.:|||||..|.....|.|.....|:||:.:||..|||.||||||:|.|||:|:.:||:.|:|
Human   172 LEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTD 236

  Fly   408 FGLSKILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFATSDG 472
            |||.|....:... .|:||||:|||||||:...  ||:.||||||:|.|.:::||||.||.   |
Human   237 FGLCKESIHDGTV-THTFCGTIEYMAPEILMRS--GHNRAVDWWSLGALMYDMLTGAPPFT---G 295

  Fly   473 QVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQE 537
            :.::..|. :|.|.:..:|...:..|||.:.|:|::|...|||....||.|::.||||..|||:|
Human   296 ENRKKTID-KILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEE 359

  Fly   538 LRTKRRKAPYKPTLTAEDDVQNFSNEFTDQVPEDPECDA--PPSRIRLFRGYTYVAPEHLEQMR 599
            |..::.:.|:||.|.:|:||..|.::||.|.|.|...|:  ..|..::|.|:|||||..||.::
Human   360 LLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLESVK 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 126/268 (47%)
STKc_MSK_N 266..533 CDD:270735 126/266 (47%)
S_TK_X 532..591 CDD:214529 24/60 (40%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
RPS6KB1NP_003152.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 12/38 (32%)
TOS motif 28..32 1/3 (33%)
STKc_p70S6K 94..416 CDD:270736 152/329 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..399 7/18 (39%)
Autoinhibitory domain 424..525 172/454 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1132245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.