DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and CG7156

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster


Alignment Length:615 Identity:128/615 - (20%)
Similarity:224/615 - (36%) Gaps:203/615 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NGKTRKNSNSETMTNGKKSKLNTEGSGSGSGKT-----------------LNYN----------- 90
            ||...|....|     :..:|.||.:|.|||.:                 |.|:           
  Fly   128 NGSPLKKLYVE-----RSLRLQTEDNGCGSGGSETGTCAGAIADICDKLDLPYDPHDAGGITPLD 187

  Fly    91 -----NNNNNNNSISATNGQY-TNSSSKTTSA-SARDYTYRETISPPTPPSPPTTNVADIVCISD 148
                 ...||.:....|..:. |....||..| :.|||     :...||.:...::.:|.:..:.
  Fly   188 PRCDKEQTNNESQAKETEIELETKQEPKTDVALTKRDY-----LRLLTPMASIESDDSDYIYEAA 247

  Fly   149 AESEDGRDPEREYYDQDMEEDEPNGIEIDESSSSLSKAKSNNAAAAAAAAAAAAAAAASKASSST 213
            .|.......|......:..|...:|:::     .|:.||.:::......|.|..|...::|..  
  Fly   248 LEFSHAVQAEVNLEYAEAHERYKHGVDL-----LLNGAKQDSSEERRFIAKAKIAKYLARAEE-- 305

  Fly   214 TPSYAMPTSNSTPLDLDNEAHQRDLEAVTDLKYYVKLYSDEAVSLND----------FKIIRVLG 268
              .:|...:|..|              ...|::.:.|.:.:..|::.          :|::::| 
  Fly   306 --IHANFLANDCP--------------TKKLQFQLSLDTTDGGSVSHLECPWNQLARYKVLQIL- 353

  Fly   269 TGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQK--RKTAEHTKTERVVLEAIQRNPFLVSLHY 331
               ..||..|:.:|:.           .:...:.|  .|.|.|:.|:.:.|.  |:.|::|.|..
  Fly   354 ---QDRVMQVQCVTKS-----------QQPAAIMKGVEKPASHSLTQSIFLP--QQVPYMVQLLA 402

  Fly   332 AFQSSSKLYLVLDFANGGELFTHL----------------------------------------- 355
            .|||..|::|:|..|.||.|:.:|                                         
  Fly   403 YFQSEQKIFLLLRQAEGGMLYDYLQSYTPTSSKSVNYGELFPSDQEPEEKEAEEPPLTSDSDVSD 467

  Fly   356 ------------------------------------YHSENFEESRVRVYIAEVVLALEQLHQLG 384
                                                ..|:...|..:|.:..|:.:|:..||..|
  Fly   468 LVRSSQQLLKSVTNTLSNLQAGVVTPKRNKKVDQNRIRSKPIPEQCLRQWACELAIAIHSLHGKG 532

  Fly   385 IIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLE-----YMAPE---IIRTGP 441
            :|.||:.:.||||..:|.::|:.|..::.||:::.| .|... .||     ::|||   ..|:  
  Fly   533 VILRDLHMGNILLGAKGQLLLTYFYQNEGLTSDDNY-VHKAL-NLEAVANHFVAPERPLTFRS-- 593

  Fly   442 PGHDSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKML 506
                   ||||.||:.::||.|.....|..||:   ::...:|  .|......|.:|:|.:.::|
  Fly   594 -------DWWSYGVVLYQLLLGVPYKVTHPGQL---DLYGCVQ--YPSESLEISDHAKDLLEQLL 646

  Fly   507 EKNPKRRLGGNHRDASEIKEHPFFNGINWQ 536
            :.:|:.||     |..:::.||||.||:||
  Fly   647 QLSPELRL-----DYDQLQAHPFFKGIDWQ 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 79/355 (22%)
STKc_MSK_N 266..533 CDD:270735 80/353 (23%)
S_TK_X 532..591 CDD:214529 4/5 (80%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 14/82 (17%)
PKc_like 343..665 CDD:304357 79/359 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.