DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and akt2

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_937789.1 Gene:akt2 / 378972 ZFINID:ZDB-GENE-031007-5 Length:479 Species:Danio rerio


Alignment Length:409 Identity:156/409 - (38%)
Similarity:224/409 - (54%) Gaps:51/409 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 AAAAAAAASKASSSTTP---SYAMPTSNSTPLDLDNEAHQRDLE----AVTDLKYYVKLYSDEAV 256
            |..|.|...|:.....|   ::..|..||             ||    |:|.        |...|
Zfish   102 AIQAVANGLKSREEDEPMDINFGSPGDNS-------------LEGMEAAITK--------SRTKV 145

  Fly   257 SLNDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVLEAIQ 321
            :::||..:::||.|.:|:|.|||:..   .|..||||:|.|..::.|.:.| ||.||..||:. .
Zfish   146 TMSDFDYLKLLGKGTFGKVILVREKA---TGMYYAMKILRKEVIIAKDEVA-HTITESRVLQN-T 205

  Fly   322 RNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQLGII 386
            |:|||.:|.||||:..:|..|:::|||||||.||.....|.|.|.|.|.||:|.|||.||...::
Zfish   206 RHPFLTTLKYAFQTRDRLCFVMEYANGGELFFHLSRERVFTEDRARFYGAEIVSALEYLHSKDVV 270

  Fly   387 YRDIKLENILLDGEGHIVLSDFGLSKI-LTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDW 450
            |||:||||::||.:|||.::||||.|. :|  ||....:||||.||:|||::.....|.  ||||
Zfish   271 YRDLKLENLMLDKDGHIKITDFGLCKEGIT--NEATMKTFCGTPEYLAPEVLEDNDYGR--AVDW 331

  Fly   451 WSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLG 515
            |.:||:.:|::.|..||...|    ...:...|..|:...|.:.|..|:..:..:|:|:||:|||
Zfish   332 WGLGVVMYEMMCGRLPFYNQD----HERLFELILMEEIRFPRNLSPEAKALLAGLLKKDPKQRLG 392

  Fly   516 GNHRDASEIKEHPFFNGINWQELRTKRRKAPYKPTLTAEDDVQNFSNEFTDQ----VPEDP---- 572
            |...||.|:..|.|||.:|||::..|:...|:||.:|:|.|.:.|.:|||.|    .|.|.    
Zfish   393 GGPEDAKEVMTHKFFNNMNWQDVLQKKLVPPFKPQVTSETDTRYFDDEFTAQTITVTPPDQYDSL 457

  Fly   573 ECDAPPSRIRLFRGYTYVA 591
            :.:.|.:|.. |..::|.|
Zfish   458 DAEDPDTRTH-FSQFSYSA 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 116/269 (43%)
STKc_MSK_N 266..533 CDD:270735 118/267 (44%)
S_TK_X 532..591 CDD:214529 21/66 (32%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
akt2NP_937789.1 PH_PKB 4..111 CDD:269947 3/8 (38%)
PH 6..106 CDD:278594 1/3 (33%)
S_TKc 150..407 CDD:214567 116/269 (43%)
STKc_PKB_beta 154..476 CDD:173686 140/336 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.