DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and Stk32a

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_001178823.1 Gene:Stk32a / 364858 RGDID:1308338 Length:397 Species:Rattus norvegicus


Alignment Length:399 Identity:121/399 - (30%)
Similarity:204/399 - (51%) Gaps:64/399 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 LYSDEAVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTER 314
            |..:|.|:.:.|:|:|.:|.|::|:|.:|:|   :|..|:||||.:||...|::.:.....| |.
  Rat    12 LDENEDVNFDHFEILRAIGKGSFGKVCIVQK---NDTKKMYAMKYMNKQKCVERNEVRNVFK-EL 72

  Fly   315 VVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQ 379
            .:::.:: :||||:|.|:||....:::|:|...||:|..||..:.:|:|..|:::|.|:.:||:.
  Rat    73 QIMQGLE-HPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFQEDTVKLFICELAMALDY 136

  Fly   380 LHQLGIIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRT-GPPG 443
            |....||:||:|.:|||||..||:.::||.::.:|..|.  |..:..||..|||||:..: ...|
  Rat   137 LQSQRIIHRDMKPDNILLDEHGHVHITDFNIAAMLPKET--RITTVAGTKPYMAPEMFSSRKESG 199

  Fly   444 HDSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQK--EQPMI--PSSFSANARDFVLK 504
            :..||||||:||..:|||.|..|:     .::.|..|:.|..  |..::  ||::||.....:.|
  Rat   200 YSFAVDWWSLGVTAYELLRGRRPY-----HIRSSTSSKEIVNMFETAIVTYPSAWSAEMVSLLKK 259

  Fly   505 MLEKNPKRRLGGNHRDASEIKEHPFFNGINWQELRTKRRKAPYKPT---------------LTAE 554
            :||.||.:|.  :|  .::|:..|:.:.:||..:..||....:.||               :...
  Rat   260 LLEPNPDQRF--SH--LTDIQNFPYMSDMNWDAVLQKRLIPGFVPTKGRLNCDPTFELEEMILES 320

  Fly   555 DDVQNFSNEFTDQVPEDPECDAPPSRIRLFRGYTYVAPEHL------------EQMRRDNHCEIQ 607
            ..:.........:..|..:||:|         ...:..|||            |:::||      
  Rat   321 KPLHKKKKRLAKKEKEMKKCDSP---------QMCLLQEHLDAVQKEFIIFNREKVKRD------ 370

  Fly   608 YFNTGLQNI 616
             ||....||
  Rat   371 -FNQRQANI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 98/273 (36%)
STKc_MSK_N 266..533 CDD:270735 95/271 (35%)
S_TK_X 532..591 CDD:214529 10/73 (14%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Stk32aNP_001178823.1 STKc_Yank1 22..281 CDD:270730 98/274 (36%)
S_TKc 23..270 CDD:214567 95/260 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.