DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and Stk32b

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_001100694.1 Gene:Stk32b / 305431 RGDID:1306173 Length:414 Species:Rattus norvegicus


Alignment Length:300 Identity:104/300 - (34%)
Similarity:168/300 - (56%) Gaps:15/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 DEAVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVL 317
            :|.|:.:.|:|:|.:|.|::|:|.:|:|   .|..|:||||.:||...|: |....:...|..::
  Rat    15 NEEVNFDHFQILRAIGKGSFGKVCIVQK---RDTKKMYAMKYMNKQKCVE-RDEVRNVFRELQIM 75

  Fly   318 EAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLHQ 382
            :.:: :||||:|.|:||....:::|:|...||:|..||..:.:|.|..|::|:.|:.||||.|.:
  Rat    76 QGLE-HPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTEGAVKLYVCELALALEYLQR 139

  Fly   383 LGIIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRT---GPPGH 444
            ..||:||||.:|||||..||:.::||.::.:|  :...:|.|..||..||||||.:.   |.||:
  Rat   140 YHIIHRDIKPDNILLDEHGHVHITDFNIATVL--KGTEKASSMAGTKPYMAPEIFQVYVDGGPGY 202

  Fly   445 DSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKN 509
            ...|||||:||..:|||.|..|:..... ....||....:.|:....|::.....|.:.|:|.|:
  Rat   203 SYPVDWWSLGVTAYELLRGWRPYEIHSA-TPVDEILNMFKVERVHYSSTWCEGMVDLLKKLLTKD 266

  Fly   510 PKRRLGGNHRDASEIKEHPFFNGINWQELRTKRRKAPYKP 549
            |:.||.    ...:|:...:...:||..:..|.....:.|
  Rat   267 PEIRLS----SLRDIQSMTYLADMNWDAVFNKALMPGFVP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 98/271 (36%)
STKc_MSK_N 266..533 CDD:270735 95/269 (35%)
S_TK_X 532..591 CDD:214529 3/17 (18%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Stk32bNP_001100694.1 STKc_Yank1 22..283 CDD:270730 98/272 (36%)
S_TKc 23..272 CDD:214567 96/256 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.