DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and Akt3

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:XP_038946556.1 Gene:Akt3 / 29414 RGDID:62390 Length:504 Species:Rattus norvegicus


Alignment Length:381 Identity:138/381 - (36%)
Similarity:204/381 - (53%) Gaps:53/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 NSTPLDLDNEAHQRDLEAVTDLKYYVKLYSDEAVSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAG 287
            |.:|....:...:.:::|.|.        ..:..::|||..:::||.|.:|:|.|||:..   :|
  Rat   141 NCSPTSQIDNIGEEEMDASTT--------HHKRKTMNDFDYLKLLGKGTFGKVILVREKA---SG 194

  Fly   288 KLYAMKVLNKITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELF 352
            |.||||:|.|..::.|.:.| ||.||..||:. .|:|||.||.|:||:..:|..|:::.||||||
  Rat   195 KYYAMKILKKEVIIAKDEVA-HTLTESRVLKN-TRHPFLTSLKYSFQTKDRLCFVMEYVNGGELF 257

  Fly   353 THLYHSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLDGEGHIVLSDFGLSK--ILT 415
            .||.....|.|.|.|.|.||:|.||:.||...|:|||:||||::||.:|||.::||||.|  |..
  Rat   258 FHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITD 322

  Fly   416 AENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEIS 480
            |..   ..:||||.||:|||::.....|.  |||||.:||:.:|::.|..||...|    ..::.
  Rat   323 AAT---MKTFCGTPEYLAPEVLEDNDYGR--AVDWWGLGVVMYEMMCGRLPFYNQD----HEKLF 378

  Fly   481 RRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQELRTKR--- 542
            ..|..|....|.:.|::|:..:..:|.|:|.:||||...||.||..|.||:|:|||::..|:   
  Rat   379 ELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKMTT 443

  Fly   543 -----------RKAPYKPTLTAEDDVQNFSNEF---------TDQVPEDPECDAPP 578
                       ..:...|||.|:      .|:|         .|...|:....:||
  Rat   444 TAWTAWIMSGGHTSLSSPTLQAD------GNKFLSVCLYTVILDFATENDSWTSPP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 115/270 (43%)
STKc_MSK_N 266..533 CDD:270735 116/268 (43%)
S_TK_X 532..591 CDD:214529 15/70 (21%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Akt3XP_038946556.1 PH_PKB 4..133 CDD:269947
PKc_like 175..442 CDD:419665 121/280 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.