DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and Rps6kc1

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:XP_006250521.1 Gene:Rps6kc1 / 289342 RGDID:1306578 Length:1045 Species:Rattus norvegicus


Alignment Length:606 Identity:131/606 - (21%)
Similarity:218/606 - (35%) Gaps:165/606 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TRKNSNSETMTNGKKSKLNTEGSGSGSGKTLNYNNNNN------------NNNSISATNGQYTNS 109
            ::.:||.|........|....||.|....|..|....|            |..|:....|:  |:
  Rat   479 SQDDSNQEDDGQDSSPKWPDSGSSSEEECTAGYLTLCNEYGQEKLDLTSLNEESVMQPEGE--NA 541

  Fly   110 SSKTTSASARDYTYRETISPPTP----P---------SPPTT--------------------NVA 141
            .|:...:.....| .::.||.|.    |         ||.|:                    :.:
  Rat   542 DSQAVRSFPASLT-ADSASPSTQLKFFPGDEGLEAVCSPRTSDSLRRSKNSPMEFFRIDSKDSTS 605

  Fly   142 DIVCISDAES---------------EDGRDPEREYYDQDMEEDEPNGIEIDESSSSLSKAKSNNA 191
            :::.:...|.               |||..|.:. :|....:.|      .|:..|:|:...::.
  Rat   606 ELLGLDSGEKLHSLKPEPLKALFTLEDGDSPSQS-FDAGKSQGE------SEAQDSISRGSDDSV 663

  Fly   192 AAAAAAAAAAAAAAASKASSS----TTPSYAMPTSNSTPLDLD--NEAHQRDLEAVTDLKYYVKL 250
            ...:...||:....:::....    ..|....||..::.:|..  ::|....|||...|  .::|
  Rat   664 PVISFKEAASEDVCSAEEGRPDLLVNLPGELQPTKETSAVDPTKFSQASIGRLEAPDVL--CLRL 726

  Fly   251 YSDEAVSL-----------NDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQKR 304
            .|::...|           .:|:         .|.|...|. .:.|.|.|:...|.:..:..|..
  Rat   727 SSEQCHDLGQEGPEELSHPTEFR---------PGGVTPERS-AQADLGVLFTATVDHSSSQDQFL 781

  Fly   305 KTAEHTKTER-------VVLEAIQRNPFLV----------SLHYAFQSSSKLYLVLD-------- 344
            .::.|::::|       |..:.:|.:.|.:          |.|....:|.::.|..:        
  Rat   782 FSSLHSESDRLGQVEGAVTSQDLQESLFHIASPCSGAKEDSAHTDTATSEEVLLFTEPSKEGDSE 846

  Fly   345 ------FANGGELFTHLYHSENFE---------------ESRVRVYIAEVVLALEQLHQLGIIYR 388
                  .|.|.|...|    :.||               |..::.:.||:|:||:.||:.||:.|
  Rat   847 AKVRSVGAGGAEKEVH----QIFEDLDQRLAVSARLFIPEGCIQRWAAEMVVALDALHREGIVCR 907

  Fly   389 DIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDS-AVDWWS 452
            |:...||||:..|||.|:.|.    ..:|.|....|......|.|||:   |....:: |.||||
  Rat   908 DLNPNNILLNDGGHIQLTYFS----RWSEVEDLCDSDAIARMYCAPEV---GAVTEETEACDWWS 965

  Fly   453 VGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRLGGN 517
            :|.:.||||||.:........:.......        :|...|..||..:.::|:.||..|||..
  Rat   966 LGAVLFELLTGKTLVECHPAGINTHTTLN--------MPDCVSEEARSLIQQLLQFNPMERLGAG 1022

  Fly   518 HRDASEIKEHPFFNGINWQEL 538
            .....:||.||||..::|.||
  Rat  1023 VAGVEDIKSHPFFTPVDWAEL 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 79/315 (25%)
STKc_MSK_N 266..533 CDD:270735 80/313 (26%)
S_TK_X 532..591 CDD:214529 3/7 (43%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Rps6kc1XP_006250521.1 PX_RPK118_like 11..128 CDD:132820
MIT_SNX15 237..305 CDD:239140
PKc_like 334..>420 CDD:304357
STKc_RPK118_like <858..1035 CDD:270728 59/195 (30%)
S_TKc <867..1035 CDD:214567 55/182 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.