DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and Rps6kl1

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_001351244.1 Gene:Rps6kl1 / 238323 MGIID:2443413 Length:545 Species:Mus musculus


Alignment Length:180 Identity:67/180 - (37%)
Similarity:92/180 - (51%) Gaps:15/180 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   360 NFEESRVRVYIAEVVLALEQLHQLGIIYRDIKLENILLD-GEGHIVLSDFGLSKILTAENEYRAH 423
            :..|.:|:.:.||::||||.|||.|::.||:..:|:||| .||||.|:.||    ..:|.|.|..
Mouse   378 SLREGQVKQWAAEMLLALEALHQQGVLCRDLNPQNLLLDQAEGHIQLTYFG----QWSEVEPRCS 438

  Fly   424 SFCGTLEYMAPEIIRTGPPGHDSAVDWWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQP 488
            .......|.|||:  .|......|.||||.|.|.:|||||.:        :.||..|......|.
Mouse   439 QEAVDCLYSAPEV--GGISELTEACDWWSYGSLLYELLTGMA--------LSQSHPSGFQAHTQL 493

  Fly   489 MIPSSFSANARDFVLKMLEKNPKRRLGGNHRDASEIKEHPFFNGINWQEL 538
            .:|...|..|...:.::|:..|:||||......|.:|.||||:.|.|..|
Mouse   494 QLPEWLSHPAASLLTELLQFEPQRRLGAGGGGTSRLKSHPFFSTIQWSRL 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 62/170 (36%)
STKc_MSK_N 266..533 CDD:270735 64/173 (37%)
S_TK_X 532..591 CDD:214529 3/7 (43%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
Rps6kl1NP_001351244.1 MIT_SNX15 48..122 CDD:239140
STKc_RPK118_like 148..535 CDD:270728 62/170 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..344
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.