DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JIL-1 and AKT1

DIOPT Version :9

Sequence 1:NP_001261697.1 Gene:JIL-1 / 39241 FlyBaseID:FBgn0020412 Length:1207 Species:Drosophila melanogaster
Sequence 2:NP_001014431.1 Gene:AKT1 / 207 HGNCID:391 Length:480 Species:Homo sapiens


Alignment Length:328 Identity:135/328 - (41%)
Similarity:199/328 - (60%) Gaps:21/328 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VSLNDFKIIRVLGTGAYGRVFLVRKLTRHDAGKLYAMKVLNKITVVQKRKTAEHTKTERVVLEAI 320
            |::|:|:.:::||.|.:|:|.||::..   .|:.||||:|.|..:|.|.:.| ||.||..||:. 
Human   145 VTMNEFEYLKLLGKGTFGKVILVKEKA---TGRYYAMKILKKEVIVAKDEVA-HTLTENRVLQN- 204

  Fly   321 QRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLYHSENFEESRVRVYIAEVVLALEQLH-QLG 384
            .|:|||.:|.|:||:..:|..|:::|||||||.||.....|.|.|.|.|.||:|.||:.|| :..
Human   205 SRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKN 269

  Fly   385 IIYRDIKLENILLDGEGHIVLSDFGLSKILTAENEYRAHSFCGTLEYMAPEIIRTGPPGHDSAVD 449
            ::|||:||||::||.:|||.::||||.| ...::.....:||||.||:|||::.....|.  |||
Human   270 VVYRDLKLENLMLDKDGHIKITDFGLCK-EGIKDGATMKTFCGTPEYLAPEVLEDNDYGR--AVD 331

  Fly   450 WWSVGVLTFELLTGASPFATSDGQVQQSEISRRIQKEQPMIPSSFSANARDFVLKMLEKNPKRRL 514
            ||.:||:.:|::.|..||...|    ..::...|..|:...|.:....|:..:..:|:|:||:||
Human   332 WWGLGVVMYEMMCGRLPFYNQD----HEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRL 392

  Fly   515 GGNHRDASEIKEHPFFNGINWQELRTKRRKAPYKPTLTAEDDVQNFSNEFTDQV----PEDP--- 572
            ||...||.||.:|.||.||.||.:..|:...|:||.:|:|.|.:.|..|||.|:    |.|.   
Human   393 GGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDS 457

  Fly   573 -EC 574
             ||
Human   458 MEC 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JIL-1NP_001261697.1 S_TKc 261..530 CDD:214567 111/269 (41%)
STKc_MSK_N 266..533 CDD:270735 112/267 (42%)
S_TK_X 532..591 CDD:214529 20/51 (39%)
S_TKc 632..886 CDD:214567
PKc_like 632..885 CDD:304357
AKT1NP_001014431.1 PH_PKB 4..111 CDD:269947
Inositol-(1,3,4,5)-tetrakisphosphate binding 14..19
Inositol-(1,3,4,5)-tetrakisphosphate binding 23..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..138
STKc_PKB_alpha 124..479 CDD:270746 135/328 (41%)
Inhibitor binding 228..230 0/1 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 450..480 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.